SCOPe 2.08: Domain d1dq9a1: 1dq9 A:587-703

Lineage for d1dq9a1 (1dq9 A:587-703)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)

8. Domain d1dq9a1: 1dq9 A:587-703 [39372]
   Other proteins in same PDB: d1dq9a4, d1dq9b4, d1dq9c4, d1dq9d4
   complexed with hmg

Details for d1dq9a1

PDB Entry: 1dq9, 2.8 Å

PDB Description: complex of catalytic portion of human hmg-coa reductase with hmg-coa

PDB Compounds: (A:) protein (hmg-coa reductase)

SCOPe Domain Sequences for d1dq9a1:

Sequence; same for both SEQRES and ATOM records:

>d1dq9a1 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

Timeline for d1dq9a1:

• d1dq9a1 first appeared (with stable ids) in SCOP 1.55
  
• d1dq9a1 appears in SCOPe 2.07