![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif |
![]() | Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families) ![]() |
![]() | Family d.176.1.1: Oxidoreductase molybdopterin-binding domain [56525] (2 proteins) Pfam PF00174 |
![]() | Protein Sulfite oxidase, middle catalytic domain [56526] (2 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56527] (6 PDB entries) |
![]() | Domain d1soxb3: 1sox B:94-343 [42564] Other proteins in same PDB: d1soxa1, d1soxa2, d1soxb1, d1soxb2 complexed with epe, gol, hem, mo, mte, so4 |
PDB Entry: 1sox (more details), 1.9 Å
SCOPe Domain Sequences for d1soxb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1soxb3 d.176.1.1 (B:94-343) Sulfite oxidase, middle catalytic domain {Chicken (Gallus gallus) [TaxId: 9031]} qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl rvdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistar wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdt vdyrtapaiq
Timeline for d1soxb3: