| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein) automatically mapped to Pfam PF03404 |
| Protein Sulfite oxidase, C-terminal domain [49259] (2 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [49260] (6 PDB entries) |
| Domain d1soxb1: 1sox B:344-466 [21948] Other proteins in same PDB: d1soxa2, d1soxa3, d1soxb2, d1soxb3 complexed with epe, gol, hem, mo, mte, so4 |
PDB Entry: 1sox (more details), 1.9 Å
SCOPe Domain Sequences for d1soxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1soxb1 b.1.18.6 (B:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd
Timeline for d1soxb1: