Lineage for d1soxa1 (1sox A:344-466)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765551Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein)
    automatically mapped to Pfam PF03404
  6. 2765552Protein Sulfite oxidase, C-terminal domain [49259] (2 species)
  7. 2765553Species Chicken (Gallus gallus) [TaxId:9031] [49260] (6 PDB entries)
  8. 2765558Domain d1soxa1: 1sox A:344-466 [21947]
    Other proteins in same PDB: d1soxa2, d1soxa3, d1soxb2, d1soxb3
    complexed with epe, gol, hem, mo, mte, so4

Details for d1soxa1

PDB Entry: 1sox (more details), 1.9 Å

PDB Description: sulfite oxidase from chicken liver
PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d1soxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soxa1 b.1.18.6 (A:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd

SCOPe Domain Coordinates for d1soxa1:

Click to download the PDB-style file with coordinates for d1soxa1.
(The format of our PDB-style files is described here.)

Timeline for d1soxa1: