Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) |
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
Protein Sulfite oxidase, N-terminal domain [55866] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [55867] (1 PDB entry) |
Domain d1soxa2: 1sox A:3-93 [41090] Other proteins in same PDB: d1soxa1, d1soxa3, d1soxb1, d1soxb3 complexed with epe, gol, hem, mo, mte, so4 |
PDB Entry: 1sox (more details), 1.9 Å
SCOPe Domain Sequences for d1soxa2:
Sequence, based on SEQRES records: (download)
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly avhgephvlellqqykvgelspdeapaapda
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly avhgephvlellqqykvgelspdeapapda
Timeline for d1soxa2: