Lineage for d1byfb_ (1byf B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein Lectin TC14 [56463] (1 species) Species Tunicate (Polyandrocarpa misakiensis) [TaxId:7723] [56464] (2 PDB entries) 
Domain d1byfb_: 1byf B: [42420]
Details for d1byfb_
PDB Entry: 1byf (more details), 2 Å
PDB Description: structure of tc14; a c-type lectin from the tunicate polyandrocarpa misakiensis
SCOP Domain Sequences for d1byfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byfb_ d.169.1.1 (B:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis)}
dyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnlq
dgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvicek
eld
SCOP Domain Coordinates for d1byfb_:
Click to download the PDB-style file with coordinates for d1byfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1byfb_:
- d1byfb_ appears in SCOP 1.57
- d1byfb_ appears in the current release, SCOPe 2.08
View in 3D
