Lineage for d1afa31 (1afa 3:105-226)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37323Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 37324Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 37325Family d.169.1.1: C-type lectin domain [56437] (13 proteins)
  6. 37357Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 37360Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries)
  8. 37410Domain d1afa31: 1afa 3:105-226 [42404]
    Other proteins in same PDB: d1afa12, d1afa22, d1afa32

Details for d1afa31

PDB Entry: 1afa (more details), 2 Å

PDB Description: structural basis of galactose recognition in c-type animal lectins

SCOP Domain Sequences for d1afa31:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afa31 d.169.1.1 (3:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvtivdnglwndiscqashtavcef
pa

SCOP Domain Coordinates for d1afa31:

Click to download the PDB-style file with coordinates for d1afa31.
(The format of our PDB-style files is described here.)

Timeline for d1afa31: