Lineage for d4kmb31 (4kmb 3:105-221)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264459Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 264460Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 264461Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 264527Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 264530Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 264602Domain d4kmb31: 4kmb 3:105-221 [42395]
    Other proteins in same PDB: d4kmb12, d4kmb22, d4kmb32
    complexed with ca, cl, fuc, gsa, mag, zn; mutant

Details for d4kmb31

PDB Entry: 4kmb (more details), 2 Å

PDB Description: complex of 4'-sulfo-lewis-x with a selectin-like mutant of mannose- binding protein a

SCOP Domain Sequences for d4kmb31:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kmb31 d.169.1.1 (3:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa

SCOP Domain Coordinates for d4kmb31:

Click to download the PDB-style file with coordinates for d4kmb31.
(The format of our PDB-style files is described here.)

Timeline for d4kmb31: