Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) |
Superfamily d.169.1: C-type lectin-like [56436] (5 families) |
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) |
Protein Mannose-binding protein A, lectin domain [56458] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries) |
Domain d4kmb31: 4kmb 3:105-221 [42395] Other proteins in same PDB: d4kmb12, d4kmb22, d4kmb32 |
PDB Entry: 4kmb (more details), 2 Å
SCOP Domain Sequences for d4kmb31:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kmb31 d.169.1.1 (3:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)} kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa
Timeline for d4kmb31:
View in 3D Domains from other chains: (mouse over for more information) d4kmb11, d4kmb12, d4kmb21, d4kmb22 |