| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) |
Superfamily d.169.1: C-type lectin-like [56436] (5 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (13 proteins) |
| Protein Mannose-binding protein A, lectin domain [56458] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries) |
| Domain d2kmb21: 2kmb 2:105-221 [42388] Other proteins in same PDB: d2kmb12, d2kmb22, d2kmb32 |
PDB Entry: 2kmb (more details), 2 Å
SCOP Domain Sequences for d2kmb21:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kmb21 d.169.1.1 (2:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa
Timeline for d2kmb21:
View in 3DDomains from other chains: (mouse over for more information) d2kmb11, d2kmb12, d2kmb31, d2kmb32 |