![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (5 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (13 proteins) |
![]() | Protein Mannose-binding protein A, lectin domain [56458] (2 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries) |
![]() | Domain d1afb31: 1afb 3:105-226 [42386] Other proteins in same PDB: d1afb12, d1afb22, d1afb32 |
PDB Entry: 1afb (more details), 1.9 Å
SCOP Domain Sequences for d1afb31:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afb31 d.169.1.1 (3:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)} kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt egqfmyvtggrltysnwkkdqpddwyghglgggedcvtivdnglwndiscqashtavcef pa
Timeline for d1afb31:
![]() Domains from other chains: (mouse over for more information) d1afb11, d1afb12, d1afb21, d1afb22 |