Lineage for d1bv4c_ (1bv4 C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37323Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 37324Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 37325Family d.169.1.1: C-type lectin domain [56437] (13 proteins)
  6. 37357Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 37360Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries)
  8. 37391Domain d1bv4c_: 1bv4 C: [42382]

Details for d1bv4c_

PDB Entry: 1bv4 (more details), 1.85 Å

PDB Description: apo-mannose-binding protein-c

SCOP Domain Sequences for d1bv4c_:

Sequence, based on SEQRES records: (download)

>d1bv4c_ d.169.1.1 (C:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

Sequence, based on observed residues (ATOM records): (download)

>d1bv4c_ d.169.1.1 (C:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgiedltgcvvll
tngkwndvpcsdsflvvcefs

SCOP Domain Coordinates for d1bv4c_:

Click to download the PDB-style file with coordinates for d1bv4c_.
(The format of our PDB-style files is described here.)

Timeline for d1bv4c_: