Lineage for d1rdj2_ (1rdj 2:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein Mannose-binding protein A, lectin domain [56458] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries) 
Domain d1rdj2_: 1rdj 2: [42370]
Details for d1rdj2_
PDB Entry: 1rdj (more details), 1.8 Å
PDB Description: mannose-binding protein, subtilisin digest fragment complex with beta- methyl-l-fucopyranoside
SCOP Domain Sequences for d1rdj2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rdj2_ d.169.1.1 (2:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
SCOP Domain Coordinates for d1rdj2_:
Click to download the PDB-style file with coordinates for d1rdj2_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rdj2_:
- d1rdj2_ appears in SCOP 1.57
- d1rdj2_ appears in the current release, SCOPe 2.08
View in 3D
