SCOP 1.55: Domain d1rtm31: 1rtm 3:105-221

Lineage for d1rtm31 (1rtm 3:105-221)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (5 families)

5. Family d.169.1.1: C-type lectin domain [56437] (13 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries)

8. Domain d1rtm31: 1rtm 3:105-221 [42365]
   Other proteins in same PDB: d1rtm12, d1rtm22, d1rtm32

Details for d1rtm31

PDB Entry: 1rtm, 1.8 Å

PDB Description: trimeric structure of a c-type mannose-binding protein

SCOP Domain Sequences for d1rtm31:

Sequence; same for both SEQRES and ATOM records:

>d1rtm31 d.169.1.1 (3:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d1rtm31:

• d1rtm31 appears in SCOP 1.57
  
• d1rtm31 appears in the current release, SCOPe 2.08