Lineage for d1ytta_ (1ytt A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein Mannose-binding protein A, lectin domain [56458] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries) 
Domain d1ytta_: 1ytt A: [42361]
Details for d1ytta_
PDB Entry: 1ytt (more details), 1.8 Å
PDB Description: yb substituted subtilisin fragment of mannose binding protein-a (sub- mbp-a), mad structure at 110k
SCOP Domain Sequences for d1ytta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytta_ d.169.1.1 (A:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
sgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevteg
qfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
SCOP Domain Coordinates for d1ytta_:
Click to download the PDB-style file with coordinates for d1ytta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ytta_:
- d1ytta_ appears in SCOP 1.57
- d1ytta_ appears in the current release, SCOPe 2.08
View in 3D
