Lineage for d1rdo2_ (1rdo 2:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein Mannose-binding protein A, lectin domain [56458] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries) 
Domain d1rdo2_: 1rdo 2: [42358]
Details for d1rdo2_
PDB Entry: 1rdo (more details), 1.7 Å
PDB Description: mannose-binding protein, subtilisin digest fragment
SCOP Domain Sequences for d1rdo2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rdo2_ d.169.1.1 (2:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
SCOP Domain Coordinates for d1rdo2_:
Click to download the PDB-style file with coordinates for d1rdo2_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rdo2_:
- d1rdo2_ appears in SCOP 1.57
- d1rdo2_ appears in the current release, SCOPe 2.08
View in 3D
