Lineage for d1e8ia_ (1e8i A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein CD69 [56442] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56443] (3 PDB entries) 
Domain d1e8ia_: 1e8i A: [42328]
Details for d1e8ia_
PDB Entry: 1e8i (more details), 1.95 Å
PDB Description: human cd69 - tetragonal form
SCOP Domain Sequences for d1e8ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8ia_ d.169.1.1 (A:) CD69 {Human (Homo sapiens)}
sscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreehw
vglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk
SCOP Domain Coordinates for d1e8ia_:
Click to download the PDB-style file with coordinates for d1e8ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e8ia_:
- d1e8ia_ appears in SCOP 1.57
- d1e8ia_ appears in the current release, SCOPe 2.08
View in 3D
