Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Green fluorescent protein, GFP [54513] (6 species) |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries) Uniprot P42212 |
Domain d7pd0a_: 7pd0 A: [423077] automated match to d6huta_ complexed with cro, gol, peg, pge |
PDB Entry: 7pd0 (more details), 2 Å
SCOPe Domain Sequences for d7pd0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7pd0a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} geelftgvvpilveldgdvnghkfsvrgegegdatygkltlkfisttgklpvpwptlvtt lgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnri elkgidfkedgnilghkleynfnchnvyitadkqkngikanfkirhnvedgsvqladhyq qntpigdgpvllpdnhylstcsvlskdpnekrdhmvllervtaagithgm
Timeline for d7pd0a_: