Lineage for d7r5ot_ (7r5o T:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2701140Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (46 PDB entries)
  8. 3086493Domain d7r5ot_: 7r5o T: [422810]
    automated match to d7a6a1_
    complexed with na

Details for d7r5ot_

PDB Entry: 7r5o (more details), 1.6 Å

PDB Description: 1.58 a structure of human apoferritin obtained from titan krios 2 at ebic, dls under commissioning session cm26464-2
PDB Compounds: (T:) Ferritin heavy chain, N-terminally processed

SCOPe Domain Sequences for d7r5ot_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7r5ot_ a.25.1.1 (T:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatd
kndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d7r5ot_:

Click to download the PDB-style file with coordinates for d7r5ot_.
(The format of our PDB-style files is described here.)

Timeline for d7r5ot_:

  • d7r5ot_ is new in SCOPe 2.08-stable