![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
![]() | Protein Vegetative insecticidal protein 2 (VIP2) [56412] (1 species) duplication: consists of two domains of this fold, the second of which is catalytic |
![]() | Species Bacillus cereus [TaxId:1396] [56413] (2 PDB entries) |
![]() | Domain d1qs1b1: 1qs1 B:1060-1264 [42262] |
PDB Entry: 1qs1 (more details), 1.5 Å
SCOPe Domain Sequences for d1qs1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qs1b1 d.166.1.1 (B:1060-1264) Vegetative insecticidal protein 2 (VIP2) {Bacillus cereus [TaxId: 1396]} tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym vhvdkvskvvkkgveclqiegtlkk
Timeline for d1qs1b1: