Lineage for d1qs1c1 (1qs1 C:2060-2264)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000560Protein Vegetative insecticidal protein 2 (VIP2) [56412] (1 species)
    duplication: consists of two domains of this fold, the second of which is catalytic
  7. 3000561Species Bacillus cereus [TaxId:1396] [56413] (2 PDB entries)
  8. 3000566Domain d1qs1c1: 1qs1 C:2060-2264 [42264]

Details for d1qs1c1

PDB Entry: 1qs1 (more details), 1.5 Å

PDB Description: crystal structure of vegetative insecticidal protein2 (vip2)
PDB Compounds: (C:) ADP-ribosyltransferase

SCOPe Domain Sequences for d1qs1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qs1c1 d.166.1.1 (C:2060-2264) Vegetative insecticidal protein 2 (VIP2) {Bacillus cereus [TaxId: 1396]}
tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
vhvdkvskvvkkgveclqiegtlkk

SCOPe Domain Coordinates for d1qs1c1:

Click to download the PDB-style file with coordinates for d1qs1c1.
(The format of our PDB-style files is described here.)

Timeline for d1qs1c1: