PDB entry 1qs1

View 1qs1 on RCSB PDB site
Description: crystal structure of vegetative insecticidal protein2 (vip2)
Class: toxin
Keywords: alpha-beta protein, binary toxin, insecticial protein
Deposited on 1999-06-25, released 1999-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.235
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyltransferase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QS1
    Domains in SCOPe 2.08: d1qs1a1, d1qs1a2
  • Chain 'B':
    Compound: ADP-ribosyltransferase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QS1
    Domains in SCOPe 2.08: d1qs1b1, d1qs1b2
  • Chain 'C':
    Compound: ADP-ribosyltransferase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QS1
    Domains in SCOPe 2.08: d1qs1c1, d1qs1c2
  • Chain 'D':
    Compound: ADP-ribosyltransferase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QS1
    Domains in SCOPe 2.08: d1qs1d1, d1qs1d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qs1A (A:)
    mkrmegklfmvskklqvvtktvllstvfsisllnnevikaeqlninsqskytnlqnlkit
    dkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsfe
    deikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfldr
    dikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngymv
    hvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreald
    gyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyqi
    sdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsai
    ggfasekeilldkdskyhidkvteviikgvkryvvdatlltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qs1A (A:)
    tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
    edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
    rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
    vhvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreal
    dgyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyq
    isdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsa
    iggfasekeilldkdskyhidkvteviikgvkryvvdatllt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qs1B (B:)
    mkrmegklfmvskklqvvtktvllstvfsisllnnevikaeqlninsqskytnlqnlkit
    dkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsfe
    deikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfldr
    dikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngymv
    hvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreald
    gyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyqi
    sdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsai
    ggfasekeilldkdskyhidkvteviikgvkryvvdatlltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qs1B (B:)
    tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
    edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
    rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
    vhvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreal
    dgyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyq
    isdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsa
    iggfasekeilldkdskyhidkvteviikgvkryvvdatllt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qs1C (C:)
    mkrmegklfmvskklqvvtktvllstvfsisllnnevikaeqlninsqskytnlqnlkit
    dkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsfe
    deikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfldr
    dikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngymv
    hvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreald
    gyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyqi
    sdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsai
    ggfasekeilldkdskyhidkvteviikgvkryvvdatlltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qs1C (C:)
    tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
    edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
    rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
    vhvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreal
    dgyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyq
    isdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsa
    iggfasekeilldkdskyhidkvteviikgvkryvvdatllt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qs1D (D:)
    mkrmegklfmvskklqvvtktvllstvfsisllnnevikaeqlninsqskytnlqnlkit
    dkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsfe
    deikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfldr
    dikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngymv
    hvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreald
    gyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyqi
    sdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsai
    ggfasekeilldkdskyhidkvteviikgvkryvvdatlltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qs1D (D:)
    tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
    edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
    rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
    vhvdkvskvvkkgveclqiegtlkksldfkndinaeahswgmknyeewakdltdsqreal
    dgyarqdykeinnylrnqggsgnekldaqiknisdalgkkpipenitvyrwcgmpefgyq
    isdplpslkdfeeqflntikedkgymstslsserlaafgsrkiilrlqvpkgstgaylsa
    iggfasekeilldkdskyhidkvteviikgvkryvvdatllt