Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) |
Family d.165.1.1: Plant cytotoxins [56372] (11 proteins) |
Protein Mistletoe lectin I A-chain [56381] (1 species) |
Species European mistletoe (Viscum album) [TaxId:3972] [56382] (2 PDB entries) |
Domain d2mlla_: 2mll A: [42195] Other proteins in same PDB: d2mllb1, d2mllb2 |
PDB Entry: 2mll (more details), 2.7 Å
SCOP Domain Sequences for d2mlla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mlla_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album)} yergdldvtaqttgagyfsfitllrdyvssgsfsnaipllsqsggggeagrfvlveltns ggdgitvaidvtnlyvvayqagsqsyflsgpggrggftgttrsslpfngsypdleqyggq rkqiplgidqliqsvtalkfpgstrtgarsililiqmiseaarfnpilwrarqyinsgas flpdvymleletswgqqstqvqhstdgvfnnpialadpgggvtltnvrdviaslaimlfv c
Timeline for d2mlla_: