Lineage for d2mlla_ (2mll A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85384Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
  4. 85385Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 85386Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)
  6. 85424Protein Mistletoe lectin I A-chain [56381] (1 species)
  7. 85425Species European mistletoe (Viscum album) [TaxId:3972] [56382] (2 PDB entries)
  8. 85427Domain d2mlla_: 2mll A: [42195]
    Other proteins in same PDB: d2mllb1, d2mllb2

Details for d2mlla_

PDB Entry: 2mll (more details), 2.7 Å

PDB Description: mistletoe lectin i from viscum album

SCOP Domain Sequences for d2mlla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mlla_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album)}
yergdldvtaqttgagyfsfitllrdyvssgsfsnaipllsqsggggeagrfvlveltns
ggdgitvaidvtnlyvvayqagsqsyflsgpggrggftgttrsslpfngsypdleqyggq
rkqiplgidqliqsvtalkfpgstrtgarsililiqmiseaarfnpilwrarqyinsgas
flpdvymleletswgqqstqvqhstdgvfnnpialadpgggvtltnvrdviaslaimlfv
c

SCOP Domain Coordinates for d2mlla_:

Click to download the PDB-style file with coordinates for d2mlla_.
(The format of our PDB-style files is described here.)

Timeline for d2mlla_: