PDB entry 2mll

View 2mll on RCSB PDB site
Description: mistletoe lectin i from viscum album
Deposited on 1999-03-16, released 2000-03-20
The last revision prior to the SCOP 1.59 freeze date was dated 2000-03-20, with a file datestamp of 2000-03-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.251
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mllA (A:)
    yergdldvtaqttgagyfsfitllrdyvssgsfsnaipllsqsggggeagrfvlveltns
    ggdgitvaidvtnlyvvayqagsqsyflsgpggrggftgttrsslpfngsypdleqyggq
    rkqiplgidqliqsvtalkfpgstrtgarsililiqmiseaarfnpilwrarqyinsgas
    flpdvymleletswgqqstqvqhstdgvfnnpialadpgggvtltnvrdviaslaimlfv
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mllB (B:)
    csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
    lttygytagvyvmifdcatavgeatvwqiwgngtiinprsnlvlaassgikgttltvqtl
    dytlgqgwlagndtaprevtiygfndlcmesgggsvtvetcssgkadkwalygdgsirpe
    qnqaqcltsggdsvagvnivscsgaasgqrwvftnegailnlknglamdvanpgggriii
    ypatgkpnqmwlpvf