Lineage for d7f5oc_ (7f5o C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875255Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2875600Protein automated matches [190252] (5 species)
    not a true protein
  7. 2875603Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries)
  8. 3085570Domain d7f5oc_: 7f5o C: [421887]
    Other proteins in same PDB: d7f5oa2
    automated match to d4y14b_
    complexed with iod

Details for d7f5oc_

PDB Entry: 7f5o (more details), 1.7 Å

PDB Description: crystal structure of ptpn2 catalytic domain
PDB Compounds: (C:) Tyrosine-protein phosphatase non-receptor type 2

SCOPe Domain Sequences for d7f5oc_:

Sequence, based on SEQRES records: (download)

>d7f5oc_ c.45.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pttierefeeldtqrrwqplyleirneshdyphrvakfpenrnrnryrdvspydhsrvkl
qnaendyinaslvdieeaqrsyiltqgplpntcchfwlmvwqqktkavvmlnrivekesv
kcaqywptddqemlfketgfsvkllsedvksyytvhllqleninsgetrtishfhyttwp
dfgvpespasflnflfkvresgslnpdhgpavihcsagigrsgtfslvdtclvlmekgdd
inikqvllnmrkyrmgliqtpdqlrfsymaiiegakcikgdssiqkrwkelske

Sequence, based on observed residues (ATOM records): (download)

>d7f5oc_ c.45.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pttierefeeldtqrrwqplyleirneshdyphrvakfpenrnrnryrdvspydhsrvkl
qnaendyinaslvdieeaqrsyiltqgplpntcchfwlmvwqqktkavvmlnrivekesv
kcaqywptddqemlfketgfsvkllsedvksyytvhllqleninsgetrtishfhyttwp
dfgvpespasflnflfkvresgslnpdhgpavihcsagigrsgtfslvdtclvlminikq
vllnmrkyrmgliqtpdqlrfsymaiiegakqkrwkelske

SCOPe Domain Coordinates for d7f5oc_:

Click to download the PDB-style file with coordinates for d7f5oc_.
(The format of our PDB-style files is described here.)

Timeline for d7f5oc_:

  • d7f5oc_ is new in SCOPe 2.08-stable