Lineage for d4y14b_ (4y14 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) 
share with the family I the common active site structure with a circularly permuted topology
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
has an extension to the beta-sheet of 3 antiparallel strands before strand 4
Protein Tyrosine phosphatase [52806] (7 species) Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (268 PDB entries)
Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
Domain d4y14b_: 4y14 B: [275721]
automated match to d2cnia_
complexed with c0a, cl, gol, trs
Details for d4y14b_
PDB Entry: 4y14 (more details), 1.9 Å
PDB Description: structure of protein tyrosine phosphatase 1b complexed with inhibitor (ptp1b:cpt157633)
PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type 1SCOPe Domain Sequences for d4y14b_:
Sequence, based on SEQRES records: (download)
>d4y14b_ c.45.1.2 (B:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedlep
Sequence, based on observed residues (ATOM records): (download)
>d4y14b_ c.45.1.2 (B:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrsvd
ikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedlep
SCOPe Domain Coordinates for d4y14b_:
Click to download the PDB-style file with coordinates for d4y14b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4y14b_:
- d4y14b_ first appeared in SCOPe 2.05
- d4y14b_ appears in SCOPe 2.07
View in 3D
