SCOPe 2.04: Domain d1qd2a_: 1qd2 A:

Lineage for d1qd2a_ (1qd2 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein alpha-Trichosanthin [56373] (1 species)

7. Species Mongolian snake gourd (Trichosanthes kirilowii Maxim.) [TaxId:3677] [56374] (9 PDB entries)

8. Domain d1qd2a_: 1qd2 A: [42180]
   complexed with ade

Details for d1qd2a_

PDB Entry: 1qd2, 1.86 Å

PDB Description: crystal structure of the complex of trichosanthin with adenine, obtained from trichosanthin complexed with the dinucleotide apg

PDB Compounds: (A:) trichosanthin

SCOPe Domain Sequences for d1qd2a_:

Sequence; same for both SEQRES and ATOM records:

>d1qd2a_ d.165.1.1 (A:) alpha-Trichosanthin {Mongolian snake gourd (Trichosanthes kirilowii Maxim.) [TaxId: 3677]}
dvsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadeti
svaidvtnvyimgyragdtsyffneasateaakyvfkdamrkvtlpysgnyerlqtaagk
ireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktfl
pslaiislenswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsniall
lnrnnma

Timeline for d1qd2a_:

• d1qd2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qd2a_ appears in SCOPe 2.03
  
• d1qd2a_ appears in SCOPe 2.05
  
• d1qd2a_ appears in the current release, SCOPe 2.08