PDB entry 1qd2

View 1qd2 on RCSB PDB site
Description: crystal structure of the complex of trichosanthin with adenine, obtained from trichosanthin complexed with the dinucleotide apg
Class: hydrolase
Keywords: enzyme-product complex obtained from enzyme-substrate analog complex, hydrolase
Deposited on 1999-07-09, released 2000-04-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.163
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trichosanthin
    Species: Trichosanthes kirilowii [TaxId:3677]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qd2a_
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qd2A (A:)
    dvsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadeti
    svaidvtnvyimgyragdtsyffneasateaakyvfkdamrkvtlpysgnyerlqtaagk
    ireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktfl
    pslaiislenswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsniall
    lnrnnma