SCOPe 2.08: Domain d7e2ua1: 7e2u A:4-82

Lineage for d7e2ua1 (7e2u A:4-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.22: GUN4-associated domain [140825] (2 proteins)
   PfamB PB089177
   this is a repeat family; one repeat unit is 1z3x A:34-71 found in domain

6. Protein Mg-chelatase cofactor Gun4 [140826] (2 species)
   Ycf53-like protein sll0558

7. Species Synechocystis sp. [TaxId:1111708] [273033] (5 PDB entries)

8. Domain d7e2ua1: 7e2u A:4-82 [421463]
   Other proteins in same PDB: d7e2ua2
   automated match to d1y6ia1
   complexed with cl, gol, trs, upb

Details for d7e2ua1

PDB Entry: 7e2u, 1.7 Å

PDB Description: synechocystis gun4 in complex with phytochrome

PDB Compounds: (A:) Ycf53-like protein

SCOPe Domain Sequences for d7e2ua1:

Sequence; same for both SEQRES and ATOM records:

>d7e2ua1 a.118.1.22 (A:4-82) Mg-chelatase cofactor Gun4 {Synechocystis sp. [TaxId: 1111708]}
nltelsqqlhdasekkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyqtlr
nleqetittqlqrnyptgi

Timeline for d7e2ua1:

• d7e2ua1 is new in SCOPe 2.08-stable