SCOPe 2.08: Domain d7e2ua2: 7e2u A:83-233

Lineage for d7e2ua2 (7e2u A:83-233)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.261: GUN4-like [140868] (1 superfamily)
   multihelical; open array, trapping inside an extended region before the C-terminal helix

4. Superfamily a.261.1: GUN4-like [140869] (1 family)
   automatically mapped to Pfam PF05419

5. Family a.261.1.1: GUN4-like [140870] (2 proteins)
   Pfam PF05419

6. Protein Mg-chelatase cofactor Gun4 [140871] (2 species)
   Ycf53-like protein sll0558

7. Species Synechocystis sp. [TaxId:1111708] [273035] (5 PDB entries)

8. Domain d7e2ua2: 7e2u A:83-233 [421464]
   Other proteins in same PDB: d7e2ua1
   automated match to d1y6ia2
   complexed with cl, gol, trs, upb

Details for d7e2ua2

PDB Entry: 7e2u, 1.7 Å

PDB Description: synechocystis gun4 in complex with phytochrome

PDB Compounds: (A:) Ycf53-like protein

SCOPe Domain Sequences for d7e2ua2:

Sequence; same for both SEQRES and ATOM records:

>d7e2ua2 a.261.1.1 (A:83-233) Mg-chelatase cofactor Gun4 {Synechocystis sp. [TaxId: 1111708]}
fplqsaqgidylplqealgsqdfetadeitrdklcelagpgasqrqwlyftevekfpald
lhtinalwwlhsngnfgfsvqrrlwlasgkeftklwpkigwksgnvwtrwpkgftwdlsa
pqghlpllnqlrgvrvaeslyrhpvwsqygw

Timeline for d7e2ua2:

• d7e2ua2 is new in SCOPe 2.08-stable