Lineage for d7dqef3 (7dqe F:352-454)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717615Species Enterococcus hirae [TaxId:768486] [324662] (7 PDB entries)
  8. 3084982Domain d7dqef3: 7dqe F:352-454 [421299]
    Other proteins in same PDB: d7dqee1, d7dqee2, d7dqef1, d7dqef2
    automated match to d3vr2d3
    complexed with adp, mg, so4; mutant

Details for d7dqef3

PDB Entry: 7dqe (more details), 2.69 Å

PDB Description: crystal structure of the adp-bound mutant a(s23c)3b(n64c)3 complex from enterococcus hirae v-atpase
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d7dqef3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dqef3 a.69.1.0 (F:352-454) automated matches {Enterococcus hirae [TaxId: 768486]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkyl

SCOPe Domain Coordinates for d7dqef3:

Click to download the PDB-style file with coordinates for d7dqef3.
(The format of our PDB-style files is described here.)

Timeline for d7dqef3:

  • d7dqef3 is new in SCOPe 2.08-stable