Class a: All alpha proteins [46456] (290 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Enterococcus hirae [TaxId:768486] [324662] (7 PDB entries) |
Domain d7dqef3: 7dqe F:352-454 [421299] Other proteins in same PDB: d7dqee1, d7dqee2, d7dqef1, d7dqef2 automated match to d3vr2d3 complexed with adp, mg, so4; mutant |
PDB Entry: 7dqe (more details), 2.69 Å
SCOPe Domain Sequences for d7dqef3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dqef3 a.69.1.0 (F:352-454) automated matches {Enterococcus hirae [TaxId: 768486]} kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene yvnqgfytnrtitetldlgwellamlprtelkrikddlldkyl
Timeline for d7dqef3: