Lineage for d7dqee1 (7dqe E:1-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798908Species Enterococcus hirae [TaxId:768486] [324658] (7 PDB entries)
  8. 3085068Domain d7dqee1: 7dqe E:1-75 [421385]
    Other proteins in same PDB: d7dqee2, d7dqee3, d7dqef2, d7dqef3
    automated match to d3vr2d1
    complexed with adp, mg, so4; mutant

Details for d7dqee1

PDB Entry: 7dqe (more details), 2.69 Å

PDB Description: crystal structure of the adp-bound mutant a(s23c)3b(n64c)3 complex from enterococcus hirae v-atpase
PDB Compounds: (E:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d7dqee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dqee1 b.49.1.0 (E:1-75) automated matches {Enterococcus hirae [TaxId: 768486]}
mikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegt
sgiclknssvrflgh

SCOPe Domain Coordinates for d7dqee1:

Click to download the PDB-style file with coordinates for d7dqee1.
(The format of our PDB-style files is described here.)

Timeline for d7dqee1:

  • d7dqee1 is new in SCOPe 2.08-stable