| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Malate dehydrogenase [56329] (12 species) |
| Species Haloarcula marismortui [TaxId:2238] [56335] (6 PDB entries) |
| Domain d1hlpb2: 1hlp B:163-328 [42113] Other proteins in same PDB: d1hlpa1, d1hlpb1 complexed with nad |
PDB Entry: 1hlp (more details), 3.2 Å
SCOPe Domain Sequences for d1hlpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlpb2 d.162.1.1 (B:163-328) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
grldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeqll
gdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafgvp
vrlgsngveeivewdlddyeqdlmadaaeklsdqydkis
Timeline for d1hlpb2: