Lineage for d1hlpb1 (1hlp B:21-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844748Protein Malate dehydrogenase [51849] (13 species)
  7. 2844801Species Haloarcula marismortui [TaxId:2238] [51855] (6 PDB entries)
  8. 2844813Domain d1hlpb1: 1hlp B:21-162 [30146]
    Other proteins in same PDB: d1hlpa2, d1hlpb2
    complexed with nad

Details for d1hlpb1

PDB Entry: 1hlp (more details), 3.2 Å

PDB Description: structural features stabilizing halophilic malate dehydrogenase from an archaebacterium
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1hlpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlpb1 c.2.1.5 (B:21-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvigfg

SCOPe Domain Coordinates for d1hlpb1:

Click to download the PDB-style file with coordinates for d1hlpb1.
(The format of our PDB-style files is described here.)

Timeline for d1hlpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hlpb2