| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Malate dehydrogenase [56329] (12 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [56330] (3 PDB entries) |
| Domain d1mldc2: 1mld C:145-313 [42091] Other proteins in same PDB: d1mlda1, d1mldb1, d1mldc1, d1mldd1 complexed with cit |
PDB Entry: 1mld (more details), 1.83 Å
SCOPe Domain Sequences for d1mldc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mldc2 d.162.1.1 (C:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
vttldivranafvaelkgldparvsvpvigghagktiiplisqctpkvdfpqdqlstltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetdcpyf
stplllgkkgieknlgigkispfeekmiaeaipelkasikkgeefvknm
Timeline for d1mldc2: