Lineage for d1mldc1 (1mld C:1-144)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844748Protein Malate dehydrogenase [51849] (13 species)
  7. 2844816Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries)
  8. 2844819Domain d1mldc1: 1mld C:1-144 [30124]
    Other proteins in same PDB: d1mlda2, d1mldb2, d1mldc2, d1mldd2
    complexed with cit

Details for d1mldc1

PDB Entry: 1mld (more details), 1.83 Å

PDB Description: refined structure of mitochondrial malate dehydrogenase from porcine heart and the consensus structure for dicarboxylic acid oxidoreductases
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d1mldc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mldc1 c.2.1.5 (C:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
nstipitaevfkkhgvynpnkifg

SCOPe Domain Coordinates for d1mldc1:

Click to download the PDB-style file with coordinates for d1mldc1.
(The format of our PDB-style files is described here.)

Timeline for d1mldc1: