Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Malate dehydrogenase [51849] (13 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries) |
Domain d1mldc1: 1mld C:1-144 [30124] Other proteins in same PDB: d1mlda2, d1mldb2, d1mldc2, d1mldd2 complexed with cit |
PDB Entry: 1mld (more details), 1.83 Å
SCOPe Domain Sequences for d1mldc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mldc1 c.2.1.5 (C:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv nstipitaevfkkhgvynpnkifg
Timeline for d1mldc1: