SCOPe 2.08: Domain d7beuc2: 7beu C:85-217

Lineage for d7beuc2 (7beu C:85-217)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
   Uniprot P09488 P28161

8. Domain d7beuc2: 7beu C:85-217 [420812]
   Other proteins in same PDB: d7beua1, d7beub1, d7beuc1, d7beud1
   automated match to d1xw6a1
   complexed with na

Details for d7beuc2

PDB Entry: 7beu, 1.59 Å

PDB Description: human glutathione transferase m1-1

PDB Compounds: (C:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d7beuc2:

Sequence; same for both SEQRES and ATOM records:

>d7beuc2 a.45.1.1 (C:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

Timeline for d7beuc2:

• d7beuc2 is new in SCOPe 2.08-stable