SCOPe 2.08: Domain d7amhb_: 7amh B:

Lineage for d7amhb_ (7amh B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Schistosoma mansoni [TaxId:6183] [420379] (2 PDB entries)

8. Domain d7amhb_: 7amh B: [420412]
   automated match to d2dwwa_
   complexed with rn5

Details for d7amhb_

PDB Entry: 7amh, 1.86 Å

PDB Description: smbrd3(2), second bromodomain of bromodomain 3 from schistosoma mansoni in complex with dm-a-33, an ibet726 analogue

PDB Compounds: (B:) Putative bromodomain-containing protein 3, brd3

SCOPe Domain Sequences for d7amhb_:

Sequence; same for both SEQRES and ATOM records:

>d7amhb_ a.29.2.0 (B:) automated matches {Schistosoma mansoni [TaxId: 6183]}
rlsealkacsnilkdissqryrdlnhfflkpvdvvalglhdyydvvkkamdlstiktkle
sgqyhtkydfaddvrlmfnncykyngedsevarvgkqlqaifdenfakvpdde

Timeline for d7amhb_:

• d7amhb_ is new in SCOPe 2.08-stable