Lineage for d7amha_ (7amh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 3084062Species Schistosoma mansoni [TaxId:6183] [420379] (2 PDB entries)
  8. 3084131Domain d7amha_: 7amh A: [420448]
    automated match to d2dwwa_
    complexed with rn5

Details for d7amha_

PDB Entry: 7amh (more details), 1.86 Å

PDB Description: smbrd3(2), second bromodomain of bromodomain 3 from schistosoma mansoni in complex with dm-a-33, an ibet726 analogue
PDB Compounds: (A:) Putative bromodomain-containing protein 3, brd3

SCOPe Domain Sequences for d7amha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7amha_ a.29.2.0 (A:) automated matches {Schistosoma mansoni [TaxId: 6183]}
lrlsealkacsnilkdissqryrdlnhfflkpvdvvalglhdyydvvkkamdlstiktkl
esgqyhtkydfaddvrlmfnncykyngedsevarvgkqlqaifdenfakvpdd

SCOPe Domain Coordinates for d7amha_:

Click to download the PDB-style file with coordinates for d7amha_.
(The format of our PDB-style files is described here.)

Timeline for d7amha_:

  • d7amha_ is new in SCOPe 2.08-stable