Lineage for d7m8qe_ (7m8q E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703703Species Methylosinus trichosporium [TaxId:595536] [392644] (12 PDB entries)
  8. 2703722Domain d7m8qe_: 7m8q E: [418365]
    Other proteins in same PDB: d7m8qc_, d7m8qd_, d7m8qg_, d7m8qh_
    automated match to d6d7ke_
    complexed with bez, edo, fe, ftr, na

Details for d7m8qe_

PDB Entry: 7m8q (more details), 2.08 Å

PDB Description: complex structure of methane monooxygenase hydroxylase and regulatory subunit with fluorosubstituted tryptophans
PDB Compounds: (E:) Methane monooxygenase component A alpha chain

SCOPe Domain Sequences for d7m8qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m8qe_ a.25.1.2 (E:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
dalkvnrapvgvepqevhkwlqsfnwdfkenrtkyptkyhmanetkeqfkviakeyarme
aakderqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaasamlwdsataa
eqkngylaqvldeirhthqcafinhyyskhyhdpaghndarrtraigplwkgmkrvfadg
fisgdavecsvnlqlvgeacftnplivavtewasangdeitptvflsvetdelrhmangy
qtvvsiandpasakflntdlnnafwtqqkyftpvlgylfeygskfkvepwvktwnrwvye
dwggiwigrlgkygvespaslrdakrdaywahhdlalaayamwplgfarlalpdeedqaw
feanypgwadhygkifnewkklgyedpksgfipyqwllanghdvyidrvsqvpfipslak
gtgslrvhefngkkhsltddwgerqwlieperyechnvfeqyegrelseviaeghgvrsd
gktliaqphtrgdnlwtledikragcvfpdplakf

SCOPe Domain Coordinates for d7m8qe_:

Click to download the PDB-style file with coordinates for d7m8qe_.
(The format of our PDB-style files is described here.)

Timeline for d7m8qe_:

  • d7m8qe_ is new in SCOPe 2.08-stable