Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [420023] (34 PDB entries) |
Domain d6jaga1: 6jag A:3-402 [416212] Other proteins in same PDB: d6jaga2 automated match to d6dtqa_ complexed with cit, fru, glc, gol |
PDB Entry: 6jag (more details), 1.85 Å
SCOPe Domain Sequences for d6jaga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jaga1 c.94.1.0 (A:3-402) automated matches {Thermus thermophilus [TaxId: 300852]} gpvirvagdstavgeggrwmkemveawgkktgtrveyidspadtndrlalyqqywaarsp dvdvymidviwpgivaphaldlkpylteaelkeffprivqnntirgkltslpfftdagil yyrkdllekygytspprtwneleqmaervmegerragnrdfwgfvfqgkpyegltcdale wiyshgggrivepdgtisvnngraalalnrahgwvgriapqgvtsyaeeearnvwqqgns lfmrnwpyayalgqaegspirgkfgvtvlpkasadapnaatlggwqlmvsaysrypkeav dlvkylasyevqkdnavrlsrlptrpalytdrdvlarnpwfrdllpvfqnavsrpsdvag arynqvseaiwtevhsvltgrkkgeqavrdlearirrilr
Timeline for d6jaga1: