Lineage for d6jaga1 (6jag A:3-402)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916319Species Thermus thermophilus [TaxId:300852] [420023] (34 PDB entries)
  8. 2916342Domain d6jaga1: 6jag A:3-402 [416212]
    Other proteins in same PDB: d6jaga2
    automated match to d6dtqa_
    complexed with cit, fru, glc, gol

Details for d6jaga1

PDB Entry: 6jag (more details), 1.85 Å

PDB Description: crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose
PDB Compounds: (A:) ABC transporter, periplasmic substrate-binding protein

SCOPe Domain Sequences for d6jaga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jaga1 c.94.1.0 (A:3-402) automated matches {Thermus thermophilus [TaxId: 300852]}
gpvirvagdstavgeggrwmkemveawgkktgtrveyidspadtndrlalyqqywaarsp
dvdvymidviwpgivaphaldlkpylteaelkeffprivqnntirgkltslpfftdagil
yyrkdllekygytspprtwneleqmaervmegerragnrdfwgfvfqgkpyegltcdale
wiyshgggrivepdgtisvnngraalalnrahgwvgriapqgvtsyaeeearnvwqqgns
lfmrnwpyayalgqaegspirgkfgvtvlpkasadapnaatlggwqlmvsaysrypkeav
dlvkylasyevqkdnavrlsrlptrpalytdrdvlarnpwfrdllpvfqnavsrpsdvag
arynqvseaiwtevhsvltgrkkgeqavrdlearirrilr

SCOPe Domain Coordinates for d6jaga1:

Click to download the PDB-style file with coordinates for d6jaga1.
(The format of our PDB-style files is described here.)

Timeline for d6jaga1:

  • d6jaga1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6jaga2