Lineage for d6dtqa_ (6dtq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916259Species Thermotoga maritima [TaxId:243274] [187721] (11 PDB entries)
  8. 2916270Domain d6dtqa_: 6dtq A: [357818]
    automated match to d1eu8a_
    complexed with mg

Details for d6dtqa_

PDB Entry: 6dtq (more details), 2.15 Å

PDB Description: maltose bound t. maritima male3
PDB Compounds: (A:) maltose-binding protein MalE3

SCOPe Domain Sequences for d6dtqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dtqa_ c.94.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
avkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaagetd
pdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdaglly
yrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfgg
dvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrnw
pyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklikf
ltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevsd
viqryvhaaltrqttsedaikniakelkfll

SCOPe Domain Coordinates for d6dtqa_:

Click to download the PDB-style file with coordinates for d6dtqa_.
(The format of our PDB-style files is described here.)

Timeline for d6dtqa_: