SCOPe 2.08: Domain d6iyva2: 6iyv A:252-407

Lineage for d6iyva2 (6iyv A:252-407)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
   barrel, closed; n=8, S=10; one overside connection

4. Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family)
   automatically mapped to Pfam PF03734

5. Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
   Pfam PF03734; ErfK/YbiS/YcfS/YnhG

6. Protein automated matches [234004] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [419972] (10 PDB entries)

8. Domain d6iyva2: 6iyv A:252-407 [416185]
   Other proteins in same PDB: d6iyva1, d6iyvb1
   automated match to d3tura2
   complexed with 2rg, gol, peg, so4, trs

Details for d6iyva2

PDB Entry: 6iyv, 1.5 Å

PDB Description: crystal sturucture of l,d-transpeptidase ldtmt2 from mycobacterium tuberculosis in complex with ertapenem adduct

PDB Compounds: (A:) L,D-transpeptidase 2

SCOPe Domain Sequences for d6iyva2:

Sequence; same for both SEQRES and ATOM records:

>d6iyva2 b.160.1.1 (A:252-407) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eviataddntkiltvrvngevvksmptsmgkdstptangiyivgsrykhiimdsstygvp
vnspngyrtdvdwatqisysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkr
gdivevvntvggtlpgidglgdwnipwdqwragnak

Timeline for d6iyva2:

• d6iyva2 is new in SCOPe 2.08-stable