Lineage for d3tura2 (3tur A:252-407)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825385Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
    barrel, closed; n=8, S=10; one overside connection
  4. 2825386Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) (S)
    automatically mapped to Pfam PF03734
  5. 2825387Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
    Pfam PF03734; ErfK/YbiS/YcfS/YnhG
  6. 2825392Protein L,D-transpeptidase, C-terminal, catalytic domain [141525] (2 species)
  7. 2825398Species Mycobacterium tuberculosis [TaxId:1773] [419619] (6 PDB entries)
  8. 2825401Domain d3tura2: 3tur A:252-407 [413455]
    Other proteins in same PDB: d3tura1
    complexed with 0jc, 6cl, dgl, pt

Details for d3tura2

PDB Entry: 3tur (more details), 1.72 Å

PDB Description: crystal structure of m. tuberculosis ld-transpeptidase type 2 complexed with a peptidoglycan fragment
PDB Compounds: (A:) Mycobacteria Tuberculosis LD-transpeptidase type 2

SCOPe Domain Sequences for d3tura2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tura2 b.160.1.1 (A:252-407) L,D-transpeptidase, C-terminal, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
eviataddntkiltvrvngevvksmptsmgkdstptangiyivgsrykhiimdsstygvp
vnspngyrtdvdwatqisysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkr
gdivevvntvggtlpgidglgdwnipwdqwragnak

SCOPe Domain Coordinates for d3tura2:

Click to download the PDB-style file with coordinates for d3tura2.
(The format of our PDB-style files is described here.)

Timeline for d3tura2:

  • d3tura2 is new in SCOPe 2.08-stable

2825401
d3tura2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3tura1