Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.68: Anoctamin (TMEM16)-like [418720] (2 superfamilies) 10 or 11 transmembrane helices, forms dimers |
Superfamily f.68.2: DUF3412 domain [418756] (2 families) |
Family f.68.2.0: automated matches [418879] (1 protein) not a true family |
Protein automated matches [419243] (2 species) not a true protein |
Species Escherichia coli [TaxId:83333] [420015] (2 PDB entries) |
Domain d6gflb3: 6gfl B:354-439 [416003] Other proteins in same PDB: d6gfla1, d6gfla2, d6gfla4, d6gflb1, d6gflb2, d6gflb4 automated match to d2pmba3 |
PDB Entry: 6gfl (more details), 2.48 Å
SCOPe Domain Sequences for d6gflb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gflb3 f.68.2.0 (B:354-439) automated matches {Escherichia coli [TaxId: 83333]} riapdlqmpfepshenmanlklypdqpvevlaadlrrafsgivagnvkevgiraieefgp ykingdkeimrrmddllqgfvaqhrm
Timeline for d6gflb3:
View in 3D Domains from other chains: (mouse over for more information) d6gfla1, d6gfla2, d6gfla3, d6gfla4 |