Lineage for d6gflb1 (6gfl B:2-142)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956393Superfamily d.58.65: DUF4478 domain-like [418755] (2 families) (S)
  5. 2956410Family d.58.65.0: automated matches [418878] (1 protein)
    not a true family
  6. 2956411Protein automated matches [419242] (2 species)
    not a true protein
  7. 2956412Species Escherichia coli [TaxId:83333] [420013] (2 PDB entries)
  8. 2956414Domain d6gflb1: 6gfl B:2-142 [416001]
    Other proteins in same PDB: d6gfla2, d6gfla3, d6gfla4, d6gflb2, d6gflb3, d6gflb4
    automated match to d2pmba2

Details for d6gflb1

PDB Entry: 6gfl (more details), 2.48 Å

PDB Description: crystal structure of the escherichia coli nucleosidase ppnn (apo form)
PDB Compounds: (B:) Pyrimidine/purine nucleotide 5'-monophosphate nucleosidase

SCOPe Domain Sequences for d6gflb1:

Sequence, based on SEQRES records: (download)

>d6gflb1 d.58.65.0 (B:2-142) automated matches {Escherichia coli [TaxId: 83333]}
ithisplgsmdmlsqlevdmlkrtassdlyqlfrncslavlnsgsltdnskellsrfenf
dinvlrrergvklelinppeeafvdgriiralqanlfavlrdilfvygqihntvrfpnln
ldnsvhitnlvfsilrnaral

Sequence, based on observed residues (ATOM records): (download)

>d6gflb1 d.58.65.0 (B:2-142) automated matches {Escherichia coli [TaxId: 83333]}
ithisplgsmdmlsqlevdmlkrtassdlyqlfrncslavlnsgsltdnskellsrfenf
dinvlrrergvklelinppeeafvdgriiralqanlfavlrdilfvygqihdnsvhitnl
vfsilrnaral

SCOPe Domain Coordinates for d6gflb1:

Click to download the PDB-style file with coordinates for d6gflb1.
(The format of our PDB-style files is described here.)

Timeline for d6gflb1:

  • d6gflb1 is new in SCOPe 2.08-stable