Lineage for d6gfla2 (6gfl A:143-353)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922991Family c.129.1.0: automated matches [233357] (1 protein)
    not a true family
  6. 2922992Protein automated matches [233358] (8 species)
    not a true protein
  7. 2923006Species Escherichia coli [TaxId:83333] [420014] (2 PDB entries)
  8. 2923007Domain d6gfla2: 6gfl A:143-353 [415998]
    Other proteins in same PDB: d6gfla1, d6gfla3, d6gfla4, d6gflb1, d6gflb3, d6gflb4
    automated match to d2pmba1

Details for d6gfla2

PDB Entry: 6gfl (more details), 2.48 Å

PDB Description: crystal structure of the escherichia coli nucleosidase ppnn (apo form)
PDB Compounds: (A:) Pyrimidine/purine nucleotide 5'-monophosphate nucleosidase

SCOPe Domain Sequences for d6gfla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfla2 c.129.1.0 (A:143-353) automated matches {Escherichia coli [TaxId: 83333]}
hvgeapnmvvcwgghsineneylyarrvgnqlglrelnictgcgpgameapmkgaavgha
qqrykdsrfigmtepsiiaaeppnplvneliimpdiekrleafvriahgiiifpggvgta
eellyllgilmnpankdqvlpliltgpkesadyfrvldefvvhtlgenarrhyriiidda
aevarqmkksmplvkenrrdtgdaysfnwsm

SCOPe Domain Coordinates for d6gfla2:

Click to download the PDB-style file with coordinates for d6gfla2.
(The format of our PDB-style files is described here.)

Timeline for d6gfla2:

  • d6gfla2 is new in SCOPe 2.08-stable