Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) |
Family a.118.8.10: Pentatricopeptide repeat (PPR) [418869] (1 protein) Pfam PF17177 |
Protein Proteinaceous RNAse P1 (PRORP1) [419226] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [419751] (8 PDB entries) |
Domain d6bv8a1: 6bv8 A:95-299 [415750] Other proteins in same PDB: d6bv8a2, d6bv8a3 automated match to d4g25a1 protein/RNA complex; complexed with cl, jug, mn, zn |
PDB Entry: 6bv8 (more details), 2.1 Å
SCOPe Domain Sequences for d6bv8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bv8a1 a.118.8.10 (A:95-299) Proteinaceous RNAse P1 (PRORP1) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} speallkqkldmcskkgdvlealrlydearrngvqlsqyhynvllyvcslaeaatesspn pglsrgfdifkqmivdkvvpneatftngarlavakddpemafdmvkqmkafgiqprlrsy gpalfgfcrkgdadkayevdahmvesevvpeepelaallkvsmdtknadkvyktlqrlrd lvrqvskstfdmieewfksevatkt
Timeline for d6bv8a1: