SCOPe 2.08: Domain d6bv8a3: 6bv8 A:353-534

Lineage for d6bv8a3 (6bv8 A:353-534)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (4 families)

5. Family c.120.1.3: Protein-only RNAse P nuclease domain-like [418871] (1 protein)
   Pfam PF16953
   Homology to Nedd4-BP1, YacP nuclease (NYN) and PIN discussed in PubMed 17114934

6. Protein Proteinaceous RNAse P1 (PRORP1) [419228] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [419753] (8 PDB entries)

8. Domain d6bv8a3: 6bv8 A:353-534 [415752]
   Other proteins in same PDB: d6bv8a1, d6bv8a2
   automated match to d4g25a2
   protein/RNA complex; complexed with cl, jug, mn, zn

Details for d6bv8a3

PDB Entry: 6bv8, 2.1 Å

PDB Description: structure of proteinaceous rnase p 1 (prorp1) from a. thaliana complexed with mn after 3-hour soak with juglone

PDB Compounds: (A:) Proteinaceous RNase P 1, chloroplastic/mitochondrial

SCOPe Domain Sequences for d6bv8a3:

Sequence, based on SEQRES records:

>d6bv8a3 c.120.1.3 (A:353-534) Proteinaceous RNAse P1 (PRORP1) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cidinpvetetfaasltrlacerevkanfnqfqewlerhgpfdavidganmglvnqrsfs
ffqlnntvqrcqqispskrlplvilhksrvnggpatypknrallekwknagalyatppgs
nddwywlyaavsckcllvtndemrdhlfqllgnsffprwkekhqvrisvtredglklnmp
pp

Sequence, based on observed residues (ATOM records):

>d6bv8a3 c.120.1.3 (A:353-534) Proteinaceous RNAse P1 (PRORP1) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cidinpvetetfaasltrlacerevkanfnqfqewlerhgpfdavidganmglvnqrsfs
ffqlnntvqrcqqispskrlplvilhksrvatypknrallekwknagalyatppgsnddw
ywlyaavsckcllvtndemrdhlfqllgnsffprwkekhqvrisvtredglklnmppp

Timeline for d6bv8a3:

• d6bv8a3 is new in SCOPe 2.08-stable